Anti-Human DR1 Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-KB3457GNPAF |
| Quantity | :50 µg (250 µL) |
| Gene | :DR1 (Protein Dr1, Down-regulator of transcription 1, TATA-binding protein-associated phosphoprotein, Negative cofactor 2-beta, NC2-beta) |
| Immunogen | :GX5089 (GST-fusion protein, 176 amino acids) MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTIS PEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQ QAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 40% glycerol and 0.02% of NaN3 |
| Antigen Species | :Human |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Human |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:This antibody detects human DR1 protein. Other species have not been tested.
|
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
Aliases for DR1 Gene
- Down-Regulator Of Transcription 1 2 3 4 5
- TATA-Binding Protein-Associated Phosphoprotein 3 4
- Negative Cofactor 2-Beta 3 4
- Negative Cofactor 2 2 3
- Protein Dr1 3 4
- NC2-BETA 2 3
- NC2B 2 3
- NCB2 2 3
- Down-Regulator Of Transcription 1, TBP-Binding (Negative Cofactor 2) 2
- Negative Cofactor 2 Beta 2
- NC2-Beta 4
- NC2 3
- DR1 5

Related Products
Recently Viewed
Storage Bottles
$0.00
Disulfide Bond PLUS Expression Kit
$1199.18
FAM Maleimide
$797.28
FAM Amine
$797.28
Protein Silver Stain Kit
$713.04
Silicone Safety Dropper 25ml
$37.28







-Polyclonal-Antibody_Rabbit_w600x600_Diagnocine_600.jpg)














