Anti-Mouse DYNC1H1 (KIAA0325) Polyclonal Antibody, Rabbit
Anti-Mouse DYNC1H1 (KIAA0325) Polyclonal Antibody, Rabbit
DiagnoCine offers multiple types of excellent Dynein I Anti- Dynein Antibodies to researchers studying Cellular Functions, Organelle Transportation, Cellular Respiration, Mitotic Spindle Positioning, Cell Division, Microtubule, and Intracellular Replication.
Human diseases include Defective brain development, Congenital anomalies, Impaired cognitive function, Muscular dystrophy, Motor neuron degeneration, Lissencephaly, Amyotrophic lateral sclerosis, Huntington's disease, and Alzheimer's disease.
Anti- Dynein Antibodies have excellent quality and this highly pure antibody can be adapted for Western Blots research with optimization.
General information
| Cat. No. | ：FNK-MKA0325AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse dynein, cytoplasmic 1, heavy chain 1 (DYNC1H1) (mDYNC1H1, mKIAA0325) |
| Immunogen | ：GX0476 (GST-fusion protein, 94 amino acids) LDACSFGVTGLKLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTSAEKKASVVTLPVYLNFTRA DLIFTVDFEIATKEDPRSFYERGVAVLCTE |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0476. This antibody detects mDYNC1H1 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for DYNC1H1 Gene
- Dynein Cytoplasmic 1 Heavy Chain 1 2 3 5
- DHC1 2 3 4
- Dynein, Cytoplasmic, Heavy Polypeptide 1 2 3
- Cytoplasmic Dynein 1 Heavy Chain 1 3 4
- Dynein Heavy Chain, Cytosolic 3 4
- Dnchc1 2 3
- CMT2O 2 3
- DNCH1 3 4
- DNECL 3 4
- DNCL 3 4
- DYHC 3 4
- HL-3 2 3
- P22 2 3
- Cytoplasmic Dynein Heavy Chain 1 4
- KIAA0325 4
- SMALED1 3
- DYNC1H1 5
- DHC1a 3
