Anti-Mouse FDPS (KIAA1293) Polyclonal Antibody, Rabbit

Product#: FNK-MK12930505
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse FDPS (KIAA1293) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MK12930505
Quantity 50 µg (250 µL)
Gene :mouse farnesyl diphosphate synthetase, FDPS (mFDPS, mKIAA1293)
Immunogen GX0577 (GST-fusion protein, 116 amino acids)
    FFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVAR
    VKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   Western blotting (1 : 1,000), Immunohistochemistry (frozen sections, paraffin-embedded sections),
    Immunoprecipitation. Other applications have not been tested.
Specificity
Specific to recombinant protein GX0577. This antibody detects mFDPS protein. It also recognizes
    human FDPS protein. Details are shown in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 
Anti-Mouse FDPS (KIAA1293)
 MK12930505_fig1.png
Western blot analysis

Adult Mouse Tissues -
 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney,  6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen,  10:Brain, 11:Prostate.
Cell Lines -
 12:B16 cells, 13:F9 cells, 14:Neuro2A cells. 


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Gupta, S.D. et al.: J. Lipid Res., 40, 1572 (1999). 
 

Aliases for FDPS Gene

  • Farnesyl Diphosphate Synthase 2 3 4 5
  • Farnesyl Pyrophosphate Synthetase, Dimethylallyltranstransferase, Geranyltranstransferase 2 3
  • (2E,6E)-Farnesyl Diphosphate Synthase 3 4
  • Farnesyl Pyrophosphate Synthase 3 4
  • FPP Synthase 3 4
  • FPS 3 4
  • Dimethylallyltranstransferase 4
  • Geranyltranstransferase 4
  • FPP Synthetase 3
  • EC 2.5.1.10 4
  • EC 2.5.1.1 4
  • KIAA1293 4
  • POROK9 3
  • FPPS 3
  • FDPS 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X