Anti-Mouse C1orf71 (FLJ00215) Polyclonal Antibody, Rabbit

Product#: FNK-MFL0215AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse C1orf71 (FLJ00215) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MFL0215AF
Quantity 50 µg (250 µL)
Gene :mouse uncharacterized protein C1orf71 (mC1orf71, mFLJ00215)
Immunogen GX2268 (GST-fusion protein, 125 amino acids) 
    MAPEERRDSEDRVSKETEDYLHSLLERCLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQED
    LPPDESTLSLDDLAKKIEIAEAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEID
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX2268. This antibody detects mC1orf71 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
Shipping Condition  :Dry Ice 
 

Antigen Characterization 

  • Type:Primary
  • Application:Western Blot,ELISA
  • Species:Human
  • Recombinant:Yes


Human Diseases

  • Potential role in neurodegenerative disorders due to involvement in protein misfolding and aggregation pathways612
  • May be implicated in mental disorders through ER stress and autophagy mechanisms13


Cellular Signaling Pathways

  • Endoplasmic reticulum (ER) stress response pathway213
  • Unfolded protein response (UPR) signaling26
  • Autophagy pathways13
  • Protein quality control mechanisms612
     

Aliases for CNST Gene

  • Consortin, Connexin Sorting Protein 2 3 5
  • Protein Phosphatase 1, Regulatory Subunit 64 2 3
  • Consortin 3 4
  • C1orf71 3 4
  • PPP1R64 2 3
  • Chromosome 1 Open Reading Frame 71 2
  • FLJ32001 2
  • CNST 5
 


References

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
  • del Castillo, Francisco J., et al. "Consortin, a Trans-Golgi Network Cargo Receptor for the Plasma Membrane Targeting and Recycling of Connexins." Human Molecular Genetics, vol. 19, no. 2, 15 Jan. 2010, pp. 262-274.
  • "CNST Gene - Ma'ayan Laboratory, Computational Systems Biology." Ma'ayan Laboratory, Computational Systems Biology, 1 Jan. 2023, maayanlab.cloud/Harmonizome/gene/CNST.
  • "CNST Consortin, Connexin Sorting Protein [Homo Sapiens (Human)]." National Center for Biotechnology Information, U.S. National Library of Medicine, 1 Jan. 2024, www.ncbi.nlm.nih.gov/gene/163882.
  • "CNST Gene - Consortin, Connexin Sorting Protein - GeneCards." GeneCards, www.genecards.org/cgi-bin/carddisp.pl?gene=CNST.
  • "CNST - Consortin - Homo Sapiens (Human)." UniProt, www.uniprot.org/uniprotkb/Q6PJW8/entry.
Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X