Anti-Mouse ARHGEF17 (KIAA0337) Polyclonal Antibody, Rabbit
Product#: FNK-MK03370910
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse ARHGEF17 (KIAA0337) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK03370910 |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Rho guanine nucleotide exchange factor 17, ARHGEF17 (mARHGEF17, mKIAA0337) |
| Immunogen | ：GX0072 (GST-fusion protein, 158 amino acids) MLAGSDAIIRQHKAACLRITALLVCAELLWVGTSAGVVLTIPTSPSTVSCPRAPLSPAGLCQGHT GHVRFLAAVQLPEGFNLLCSTPPPPPDTGPEKLPSLDHRDSPRRRGPTSARPKMLVISGGDGS EDFRLSSGGGGSSETVGRDDSTNHLLLWRV |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0072. This antibody detects mARHGEF17 protein. Details are shown
in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Antigen Characterization
| Type | ：Rho guanine nucleotide exchange factor 17 protein |
| Application | ：ELISA, Western Blot, Immunohistochemistry (IHC) |
| Species | ：Human, Mouse, Rat |
| Recombinant | ：Yes |
ARHGEF17 in the Cell
- Functions as a Rho guanine nucleotide exchange factor
- Essential for maintaining cell-cell contacts in endothelial cells
- Regulates adherens junction proteins
- Resides in adherens junctions
- Helps regulate levels of VE-cadherin and p120-catenin
- Controls endothelial cell death and growth
- Its reduction prevents apoptosis in endothelial cells
- Induces cell cycle block in endothelial cells
ARHGEF17 in the Human Body
- Ensures proper cell division
- Maintains genomic stability
- Essential component of the spindle assembly checkpoint (SAC)
- Delays mitotic exit until chromosomes are correctly attached to the mitotic spindle
- Acts as the major targeting factor for checkpoint kinase Mps1
- Controls Mps1 localization to the kinetochore during mitosis
- Functions independently of its Rho GTPase exchange factor role in interphase
- Helps prevent chromosome missegregation
- Crucial for normal development
- Aids in preventing diseases such as cancer by maintaining genomic stability
Aliases for ARHGEF17 Gene
- Rho Guanine Nucleotide Exchange Factor 17 2 3 3 4 5
- Tumor Endothelial Marker 4 2 3 4
- P164-RhoGEF 2 3 4
- TEM4 2 3 4
- Rho-Specific Guanine-Nucleotide Exchange Factor 164 KDa 2 3
- 164 KDa Rho-Specific Guanine-Nucleotide Exchange Factor 3 4
- Rho Guanine Nucleotide Exchange Factor (GEF) 17 2 3
- KIAA0337 2 4
- P164RHOGEF 3
- P164RhoGEF 4
- RHOGEF17 3
- ARHGEF17 5
