Anti-Mouse ARHGEF12 (KIAA0382) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0382AF

$495.39

Qty:

Availability:

Ships in 1-2 Weeks

Anti-Mouse ARHGEF12 (KIAA0382) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MKA0382AF
Quantity	：50 µg (250 µL)
Gene	：mouse Rho guanine nucleotide exchange factor 12 (Leukemia-associated RhoGEF, ARHGEF12) (mARHGEF12, mKIAA0382)
Immunogen	：GX0778 (GST-fusion protein, 271 amino acids) IKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPL PQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSLNTPGKSAAEH LFVTATQFAKEQHANGALKEGDGGYPVTIPGPHLPVSEERWALDALRNLGLLKQLLVQQLGLTE KSTQEDWQSFSRYGPASEEVQADSGIRDLENVKACHAREGQMSFKTGTGDIATCDSPRTSTE SCAAQDSVILASQDSQA
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX0778. This antibody detects mARHGEF12 protein. Other species have not been tested.
Storage	：Store at -20°C. Avoid freeze-thaw cycles.

Antigen Characterization

Type	：Protein (Rho guanine nucleotide exchange factor 12)
Application	：Western Blot, ELISA, Immunofluorescence, Immunohistochemistry, Flow Cytometry
Species	：Human, Mouse, Rat
Recombinant	：Yes

.
ARHGEF12 in the Cell

Functions as a guanine nucleotide exchange factor (GEF) for RhoA, a small GTPase protein.
Activates RhoA by facilitating the exchange of GDP for GTP, transitioning RhoA to its active state.
Activation is mediated through G protein-coupled receptors linked to G12 and G13 heterotrimeric G proteins.
Regulates the cell's actin cytoskeleton, influencing cell shape changes, protrusion-retraction cycles, and migration dynamics.
Participates in Rac/Rho activity crosstalk, coordinating cell protrusion and retraction events.

ARHGEF12 in the Human Body

Involved in the regulation of blood pressure and participates in multicellular organism aging.
Plays a significant role in megakaryocyte differentiation and platelet production, essential for normal blood clotting and hemostasis.
Limits disruption of barrier function and tight junction organization in human dermal microvascular endothelial cells (HDMECs) following inflammatory stimulation.
Forms myeloid/lymphoid fusion partners in acute myeloid leukemia, suggesting a potential role in hematological malignancies.
Widespread expression across various tissues, including the brain, heart, and immune system organs, indicating contributions to multiple physiological processes throughout the body.

References