Anti-KIAA0987 Rat Homologue Gene Product (Type II Brain 4.1, Protein 4.1B, EPB41L3) Polyclonal Antibody, Rabbit

Product#: FNK-PRX-PBR-1001
$495.39
Availability:
Ships in 1-2 Weeks

Anti-KIAA0987 Rat Homologue Gene Product (Type II Brain 4.1, Protein 4.1B, EPB41L3) Polyclonal Antibody, Rabbit


General information 

Cat. No. FNK-PRX-PBR-1001
Quantity :100 µg / vial
Gene :rat EPB41L3 (KIAA0987, Type II Brain 4.1, Protein 4.1B)
Immunogen GST-fused KIAA0987 Rat Homologue (197 amino acids: P790-L986)
    PMIEPLVPEETKQSSGEKLMDGSEILSLLESARKPTEFIGGVSSTTQSWVQKLETKTETIETEVE
    PTPHPQPLSTEKVLQETVLVEERHVMNVHASGDASHTARDDVDATESAPADRHSGNGKEGSS
    VTEAAKEQRGEEADKSAPEQEQPATVSQEEDQVSAIHSSEGLEQKSHFESSTVKVESISVGSV
    SPGGVKL
Format :Rabbit IgG purified with Protein A affinity chromatography.
Constitution :0.01 M Phosphate Buffer (pH 7.4) containing with 0.15 M NaCl and 0.05 % NaN3
Presentation :Lyophilized, reconstitute with 200 µL of distilled water
Antigen Species :Rat
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse/ Rat
Application   :Western blotting (1 : 1,000), ELISA (1 : 1,000), Immunohistochemistry (1 : 25).
    Other applications have not been tested.
Specificity
:This antibody detects rat EPB41L3 protein. It also recognizes mouse EPB41L3 protein.
    Other species have not been tested.
Storage :Store at 4°C. For long term storage, make aliquots and store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Yamakawa H. & Ohara O., Gene (2000) 248(1-2):137.
  2. Ohara R. et al., Brain Res Mol Brain Res. (2000) 85(1-2):41.
  3. Terada N. et al., Histochem Cell Biol. (2003) 120(4):277.
 

Aliases for EPB41L3 Gene

  • Erythrocyte Membrane Protein Band 4.1 Like 3 2 3 5
  • 4.1B 2 3 4
  • DAL1 2 3 4
  • Differentially Expressed In Adenocarcinoma Of The Lung Protein 1 3 4
  • Band 4.1-Like Protein 3 3 4
  • KIAA0987 2 4
  • DAL-1 3 4
  • EPB41L3 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X