Anti-Human SUB1 Polyclonal Antibody, Rabbit
Product#: FNK-KB4150GNPAF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Human SUB1 Polyclonal Antibody, Rabbit
DiagnoCine offers excellent SUB1 antibody for researchers studying single-stranded DNA binding, transcription regulation, upstream activators, general transcriptional machinery, and stabilization functions of the multiprotein transcription complex.
Human diseases include Atrial Septal Defect 4 and Indolent Systemic Mastocytosis and other diseases.
This SUB1 antibody has excellent quality and this highly pure antibody can be adapted for Western Blots, ELISA, Immunohistochemistry, Immunofluorescence research with optimization.
General information
| Cat. No. | ：FNK-KB4150GNPAF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：SUB1 (Activated RNA polymerase II transcriptional coactivator p15, SUB1 homolog, Positive cofactor 4, PC4, p14) |
| Immunogen | ：GX5318 (GST-fusion protein, 110 amino acids) SSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQIS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 40% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Human |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：This antibody detects human SUB1 protein. Other species have not been tested.
|
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
Aliases for SUB1 Gene
- SUB1 Regulator Of Transcription 2 3 5
- Positive Cofactor 4 2 3 4
- PC4 2 3 4
- P14 2 3 4
- Activated RNA Polymerase II Transcriptional Coactivator P15 3 4
- SUB1 Homolog, Transcriptional Regulator 2 3
- P15 2 3
- Activated RNA Polymerase II Transcription Cofactor 4 3
- SUB1 Homolog (S. Cerevisiae) 2
- SUB1 Homolog 4
- RPO2TC1 4
- SUB1 5
Recently Viewed
Hot Hand Type M
$12.74
WEPRO7240G Core Kit
$3210.27
Cover Glass
$0.00
TN-cyclon ELISA Development Kit
$2095.06
L-Sorbose, ≧99.5%
$153.48
