Anti-Human TNRC4 Polyclonal Antibody, Rabbit
Product#: FNK-KB7008GNPAF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Human TNRC4 Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-KB7008GNPAF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：TNRC4 (CUG-BP- and ETR-3-like factor 3, CELF-3, Bruno-like protein 1, RNA-binding protein BRUNOL-1, ELAV-type RNA-binding protein 1, ETR-1, Trinucleotide repeat-containing gene 4 protein, Expanded repeat domain protein CAG/CTG 4, CAG repeat protein 4) |
| Immunogen | ：GX5067 (GST-fusion protein, 167 amino acids) MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS ALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG PDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 40% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Human |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：This antibody detects human TNRC4 protein. Other species have not been tested.
|
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
Aliases for CELF3 Gene
- CUGBP Elav-Like Family Member 3 2 3 4 5
- BRUNOL1 2 3 4
- CAGH4 2 3 4
- ERDA4 2 3 4
- Trinucleotide Repeat-Containing Gene 4 Protein 3 4
- Expanded Repeat Domain Protein CAG/CTG 4 3 4
- Expanded Repeat Domain, CAG/CTG 4 2 3
- Trinucleotide Repeat Containing 4 2 3
- CUG-BP- And ETR-3-Like Factor 3 3 4
- ELAV-Type RNA-Binding Protein 1 3 4
- RNA-Binding Protein BRUNOL-1 3 4
- CAG Repeat Protein 4 3 4
- Bruno-Like Protein 1 3 4
- CAG Repeat Domain 2 3
- ETR-1 3 4
- TNRC4 3 4
- CUGBP, Elav-Like Family Member 3 2
- CUG-BP And ETR-3 Like Factor 3 2
- MGC57297 2
- CELF-3 4
- CELF3 5
