Recombinant HIV-1 Matrix protein p17 (with Tag)
Catalog No.: DCP-CSB-MP365915HKI1-T
Size: 100 ug, 1 mg
UniProt ID: P03349
Expression System: Mammalian cell
Expression Region: 2-134aa (Partial(Matrix protein p17 Chain)
Tag information: Tag will be removed by enzymatic digestion, followed by purification)
GARASVLSGGELDKWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIDVKDTKEALEKIEEEQNKSKKKAQQAAAAAGTGNSSQVSQNY
Purity: Minimum 75% (per SDS-PAGE) as determined by SDS-PAGE with Coomassie Brilliant Blue staining and quantitative analysis using Bandscan software
** Cannot guarantee 100% removal of tag
