- Home
- Antibody
- Antigen I-K
- Anti-Mouse KCND2 (KIAA1044) Polyclonal Antibody, Rabbit (Cerebellum, Granule cell)
Anti-Mouse KCND2 (KIAA1044) Polyclonal Antibody, Rabbit (Cerebellum, Granule cell)
Product#: FNK-MK10440310
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse KCND2 (KIAA1044) Polyclonal Antibody, Rabbit (Cerebellum, Granule cell)
General information
| Cat. No. | ：FNK-MK10440310 |
| Quantity | ：100 µg (200 µL) |
| Gene | ：mouse potassium voltage-gated channel, Shal-related family, member 2 (KCND2) (mKCND2, mKIAA1044) |
| Immunogen | ：GXD01 (GST-fusion protein, 187 amino acids) YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEV ATVNRPSSHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLS NSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
| Format | ：Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Immunohistochemistry. Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GXD01. This antibody detects endogenous mKCND2 protein in
cerebellar granule cells. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Shibasaki, K. et al.: J Neurochem., 89, 897 (2004).
- Frank-Hansen, R. et al.: Clin Chim Acta., 351, 95 (2005)
Aliases for KCND2 Gene
- Potassium Voltage-Gated Channel Subfamily D Member 2 2 3 4 5
- Voltage-Gated Potassium Channel Subunit Kv4.2 3 4
- KIAA1044 2 4
- RK5 2 3
- Potassium Channel, Voltage Gated Shal Related Subfamily D, Member 2 3
- Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 2
- Voltage-Sensitive Potassium Channel 3
- KV4.2 3
- KCND2 5
- Kv4.2 2
