Anti-Mouse YEATS2 (KIAA1197) Polyclonal Antibody, Rabbit
DiagnoCine offers excellent YEATS2 | FAME4 antibody for researchers studying ATAC complex, acetyltransferase activity on histones, signaling and mechanisms of histone H3 & H4, chromatin-related organizations, crotonylation-related transcriptional repression and promotor activities.
Human diseases include Epilepsy, Familial Adult Myoclonic, 4 and Familial Adult Myoclonic Epilepsy, including other diseases associated with Chromatin organization
YEATS2 | FAME4 antibody has excellent quality and this highly pure antibody can be adapted for Western Blots, ELISA, Immunohistochemistry, Immunofluorescence research with optimization.
General information
| Cat. No. | :FNK-MKA1197AF |
| Size | :50 µg (250 µL) |
| Antigen | :Mouse |
| Host Animal | :Rabbit |
| Class | :IgG |
| Contents(Volume) | :50 μg (250 μL/vial) |
| Gene | :mouse YEATS domain containing 2 (YEATS2) (mYEATS2, mKIAA1197) |
| Format | :Affinity Purified Rabbit IgG |
| Immunogen |
:GX0258 (GST-fusion protein, 211 amino acids)
GLKTFDPMAFNHPAIKKFLESPSRSSSPTNQRSETPSANHSESDSLSQHNDFLSDK DNNSNVDVEERPPSTGEQRPSRKDTSSISGSHKRELRNADLTGDETSRLFVKKTIVV GNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLV EVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKVL |
| Constitution | : PBS containing with 40% glycerol and 0.02% of NaN3 |
| Specificity | :Specific to recombinant protein GX0258. This antibody detects mYEATS2 protein. Other species have not been tested. |
| Cross Reactivity | :Mouse |
| Label | :Unlabeled |
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
References
Aliases for YEATS2 Gene
