Anti-Mouse PHLPP (KIAA0606) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0606AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse PHLPP (KIAA0606) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0606AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse PH domain and leucine rich repeat protein phosphatase (mPHLPP, mKIAA0606) |
| Immunogen | ：GX0356 (GST-fusion protein, 118 amino acids) GSRVEVEVDIHCSRAKEKERQQHLLQVPAEASDEGIVISANEDESGLSKKADFSAVGTIGRRRA NGSVAPQERSHNVIEVAADAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEI |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0356. This antibody detects mPHLPP protein. It also recognizes
human PHLPP protein. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for PHLPP1 Gene
- PH Domain And Leucine Rich Repeat Protein Phosphatase 1 2 3 5
- SCOP 2 3 4
- Pleckstrin Homology Domain Containing, Family E (With Leucine Rich Repeats) Member 1 2 3
- PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 3 4
- Suprachiasmatic Nucleus Circadian Oscillatory Protein 3 4
- Protein Phosphatase, Mg2+/Mn2+ Dependent 3A 2 3
- PH Domain-Containing Family E Member 1 3 4
- EC 3.1.3.16 4 51
- KIAA0606 2 4
- PLEKHE1 3 4
- PHLPP 3 4
- PPM3A 2 3
- Pleckstrin Homology Domain-Containing Family E Member 1 4
- PH Domain And Leucine Rich Repeat Protein Phosphatase 2
- SCN Circadian Oscillatory Protein 3
- PHLPP1 5
- HSCOP 4
Recently Viewed
Auto Chemistry Analyzer (BK-280)
$13800.00
BSA, Flamma® 581
$466.87
Zelkovamycin, 5 mg
$475.59
Silicone Safety Dropper
$0.00
Auto Chemistry Analyzer (BK-400)
$19500.00
Western Blot
$0.00
5% Glucose Solution
$11.00
Agar BA-10, High Quality
$96.85
BSA, Flamma® 774
$466.87