Anti-Human STAT1 Polyclonal Antibody, Rabbit
Anti-Human STAT1 Polyclonal Antibody, Rabbit
DiagnoCine offers excellent STAT1 antibody for researchers studying cytokines and growth factors, receptor-associated kinases, transcription activators, signaling pathways of interferon-alpha, interferon-gamma, EGF, PDGF & IL6, cell viability in response to different cell stimuli and pathogens, and cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. The antibody is an excellent tool to study common Cytokine Receptor Gamma-Chain Family Signaling Pathways and Interleukin-11 Signaling Pathway.
Human diseases include Immunodeficiency 31A and Immunodeficiency 31C and other multiple diseases.
This STAT1 antibody has excellent quality and this highly pure antibody can be adapted for Western Blots, ELISA, Immunohistochemistry, Immunofluorescence research with optimization.
| Widely used in various signaling pathways | |
| * | Type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2 |
| * | The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. |
| * | ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN-stimulated genes (ISG), which drive the cell in an antiviral state. |
| * | In response to type II IFN (IFN-gamma), STAT1 is tyrosine- and serine-phosphorylated, then forms a homodimer termed IFN-gamma-activated factor (GAF), migrates into the nucleus, and binds to the IFN gamma activated sequence (GAS) to drive the expression of the target genes, inducing a cellular antiviral state. |
| * | Becomes activated in response to KITLG/SCF and KIT signaling. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3, and FGFR4. |
General information
| Cat. No. | ：FNK-KB3682GNPAF |
| Size | ：50 µg (250 µL) |
| Antigen | ：Human |
| Host Animal | ：Rabbit |
| Class | ：IgG |
| Contents（Volume） | ：50 μg (200 μL/vial) |
| Gene | ：STAT1 (Signal transducer and activator of transcription 1-alpha/beta, Transcription factor ISGF-3 components p91/p84) |
| Format | ：Affinity Purified Rabbit IgG |
| Immunogen |
：GX5083 (GST-fusion protein, 168 amino acids)
ELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQY SRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQST VMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFK |
| Constitution | ： PBS containing with 40% glycerol and 0.02% of NaN3 |
| Specificity | ：This antibody detects human STAT1 protein. Other species have not been tested. |
| Cross Reactivity | ：Human |
| Label | ：Unlabeled |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
Aliases for STAT1 Gene
- Signal Transducer And Activator Of Transcription 1 2 3 5
- Transcription Factor ISGF-3 Components P91/P84 2 3 4
- Signal Transducer And Activator Of Transcription 1-Alpha/Beta 3 4
- Signal Transducer And Activator Of Transcription 1, 91kDa 2 3
- Signal Transducer And Activator Of Transcription 1, 91kD 2 3
- ISGF-3 2 3
- STAT91 2 3
- CANDF7 3
- IMD31A 3
- IMD31B 3
- IMD31C 3
- STAT1 5
