Anti-Mouse MORC2A (KIAA0852) Polyclonal Antibody, Rabbit
Product#: FNK-MK08520910
$495.39
Availability:
Ships in 24 hours
Anti-Mouse MORC2A (KIAA0852) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK08520910 |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Influenza virus NS1A binding protein (mMORC2A, mKIAA0852) |
| Immunogen | ：GX1256 (GST-fusion protein, 240 amino acids) KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMK PPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRN CLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRT SEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes
human MORC2A protein. Details are shown in the InGaP database. Other species have not been tested. |
| Long Term Storage | ：-20°C or below |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type: Primary
- Application: Western Blot,Immunofluorescence,ELISA
- Species: Human
- Recombinant: Yes
Human Diseases
- Charcot-Marie-Tooth disease type 2Z (CMT2Z): Mutations in MORC2 lead to peripheral neuropathy and central nervous system involvement, characterized by axonal degeneration and cognitive impairments.
- Breast Cancer: High levels of MORC2 are associated with poor prognosis and resistance to DNA-damaging chemotherapy.
- Neuronal Apoptosis: Involved in neuronal DNA damage leading to apoptosis, particularly in conditions like CMT2Z
Cellular Signaling Pathways
- Involved in DNA damage response (DDR): MORC2 plays a role in chromatin remodeling and the recruitment of DNA repair proteins.
- Adipogenesis and Lipogenesis: Functions in lipid metabolism and cellular differentiation processes.
- Transcriptional regulation: Acts as a transcriptional repressor influencing gene expression related to stress responses and cell cycle regulation
Aliases for MORC2A Gene
- MORC Family CW-Type Zinc Finger 2 2 3 5
- Zinc Finger CW-Type Coiled-Coil Domain Protein 1 3 4
- ATPase MORC2 3 4
- KIAA0852 2 4
- ZCWCC1 3 4
- ZCW3 2 3
- Zinc Finger, CW-Type With Coiled-Coil Domain 1 2
- Zinc Finger, CW Type With Coiled-Coil Domain 1 2
- MORC Family CW-Type Zinc Finger Protein 2 4
- AC004542.C22.1 2
- EC 3.6.1.3 4
- CMT2Z 3
- MORC2 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Xie, Hong-Yan, et al. “Dimerization of MORC2 through Its C-Terminal Coiled-Coil Domain Enhances Chromatin Dynamics and Promotes DNA Repair - Cell Communication and Signaling.” BioMed Central, BioMed Central, 3 Dec. 2019, biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0477-5.
- Lee, Geon Seong, et al. “Morc2a P.S87L Mutant Mice Develop Peripheral and Central Neuropathies Associated with Neuronal DNA Damage and Apoptosis.” Disease Models & Mechanisms, U.S. National Library of Medicine, 1 Oct. 2021, www.ncbi.nlm.nih.gov/pmc/articles/PMC8560500/.
- Wang, Huan, et al. “MORC Protein Family-Related Signature within Human Disease and Cancer.” Nature News, Nature Publishing Group, 27 Nov. 2021, www.nature.com/articles/s41419-021-04393-1.
- Morc2a Microrchidia 2A [Mus Musculus (House Mouse)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=74522.
