Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit
Product#: FNK-MK11870910
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK11870910 |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Microtubule-associated protein 7 domain containing 1 (mMAP7D1, mKIAA1187) |
| Immunogen | ：GX0479 (GST-fusion protein, 179 amino acids) PTAAPSVTPSKPMAGTTDREEATRLLAEKRRQAREQREREEQERKLQAERDKRMREEQLARE AEARAEREAEARRREEQEAREKAQAEQEEQERLQKQKEEAEARSREEAERQRQEREKHFQK EEQERQERRKRLEEIMKRTRKSEAAETKVRILRLGSGSWGEERRLQRSLQSRGRIQ |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0479. This antibody detects mMAP7D1 protein. It also recognizes
human MAP7D1 protein. Details are shown in the InGaP database. Other species have not been tested. |
| Long Term Storage | ：-20°C or below |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type: Primary
- Application: Western Blot: Used to detect MAP7D1 protein levels in various samples,ELISA: Employed for quantifying MAP7D1 in biological fluids,Immunoprecipitation: Helps in isolating MAP7D1 for further analysis.
- Species: Human
- Recombinant: Yes
Human Diseases
- Cancer: Altered expression of MAP7D1 has been implicated in various cancers, potentially affecting tumor progression and response to therapy.
- Neurodegenerative Disorders: Involvement in neuronal signaling pathways suggests a role in diseases like Alzheimer's.
- Genetic Disorders: Mutations or dysregulation of MAP7D1 may contribute to specific genetic conditions affecting cellular processes.
Cellular Signaling Pathways
- DNA Damage Response (DDR): MAP7D1 interacts with key proteins like RAD50 and BRCA1, playing a crucial role in the repair of DNA double-strand breaks and cell cycle regulation.
- Microtubule Dynamics: As a microtubule-associated protein, MAP7D1 is involved in cellular transport and structural integrity, influencing signaling pathways related to cell migration and division.
- Phosphorylation Events: MAP7D1's function is regulated through phosphorylation, impacting its interactions with other proteins during stress responses.
Aliases for MAP7D1 Gene
- MAP7 Domain Containing 1 2 3 5
- Arginine/Proline-Rich Coiled-Coil Domain-Containing Protein 1 3 4
- Proline/Arginine-Rich Coiled-Coil Domain-Containing Protein 1 3 4
- Proline Arginine Rich Coiled Coil 1 2 3
- Arginine/Proline Rich Coiled-Coil 1 2 3
- MAP7 Domain-Containing Protein 1 3 4
- PARCC1 3 4
- RPRC1 3 4
- FLJ10350 2
- FLJ39022 2
- KIAA1187 4
- MAP7D1 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Dullovi, Arlinda, et al. “Microtubule-Associated Proteins MAP7 and MAP7D1 Promote DNA Double-Strand Break Repair in the G1 Cell Cycle Phase.” iScience, U.S. National Library of Medicine, 1 Feb. 2023, www.ncbi.nlm.nih.gov/pmc/articles/PMC9958362/.
- MAP7D1 Protein Expression Summary - the Human Protein Atlas, www.proteinatlas.org/ENSG00000116871-MAP7D1.
- MAP7D1 MAP7 Domain Containing 1 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=55700.
- Anti-MAP7D1 Antibody.” Www.Atlasantibodies.Com, www.atlasantibodies.com/products/primary-antibodies/triple-a-polyclonals/anti-map7d1-antibody-hpa028075/.
- Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=MAP7D1.
