Anti-Mouse KIF5C (KIAA0531) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK05310505 |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse kinesin family member 5C (mKIF5C, mKIAA0531) |
| Immunogen |
:GX0067 (GST-fusion protein, 82 amino acids)
VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTA
VHAVRGGGGGSSNSTHYQK |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Human/ Mouse |
| Application |
:Western blotting (1 : 1,000), Immunohistochemistry (frozen sections, paraffin-embedded sections),
Immunoprecipitation Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0067. This antibody detects mKIF5C protein. It also recognizes
human KIF5C protein. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse KIF5C (KIAA0531)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Kanai, Y. et al.: J. Neurosci., 20, 6374 (2000).
Aliases for KIF5C Gene
- Kinesin Family Member 5C 2 3 5
- Kinesin Heavy Chain Neuron-Specific 2 3 4
- Kinesin Heavy Chain Isoform 5C 3 4
- NKHC2 3 4
- Kinesin Heavy Chain 3
- KIAA0531 4
- CDCBM2 3
- NKHC-2 3
- KIF5C 5
- KINN 3
- NKHC 3