Anti-Mouse IVNS1ABP (KIAA0850) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK08500910 |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse Influenza virus NS1A binding protein (mIVNS1ABP, mKIAA0850) |
| Immunogen |
:GX0474 (GST-fusion protein, 172 amino acids)
SDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYN
PENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTS
PRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQF |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Human/ Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0474. This antibody detects mIVNS1ABP protein. It also recognizes human IVNS1ABP protein. Details are shown in the InGaP database.
Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Description
Mouse KIAA0850 (mKIAA0850) protein is a homologue of human KIAA0850 (ref. 1). KIAA0850 is identical to IVNS1ABP. Rabbit anti-mouse IVNS1ABP (mIVNS1ABP, mKIAA0850) antibody is raised against GST-fused recombinant protein (GX0474) containing following sequence.
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for IVNS1ABP Gene
- Influenza Virus NS1A Binding Protein 2 3 5
- Aryl Hydrocarbon Receptor-Associated Protein 3 2 3 4
- KLHL39 2 3 4
- NS1-BP 2 3 4
- ARA3 2 3 4
- Influenza Virus NS1A-Binding Protein 3 4
- Kelch-Like Family Member 39 2 3
- Kelch-Like Protein 39 3 4
- NS1-Binding Protein 3 4
- KIAA0850 2 4
- HSPC068 2 3
- FLARA3 3 4
- NS1BP 3 4
- NS-1 2 3
- ND1 2 3
- Aryl Hydrocarbon Receptor-Associated 3 3
- NCX Downstream Gene 1 3
- IVNS1ABP 5
- NS1 4