Anti-Mouse GCC2 (KIAA0336) Polyclonal Antibody, Rabbit
Product#: FNK-MK03360310
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse GCC2 (KIAA0336) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK03360310 |
| Quantity | ：100 µg (200 µL) |
| Gene | ：mouse GRIP and coiled-coil domain-containing protein 2 (mGCC2, mKIAA0336) |
| Immunogen | ：GX0491 (GST-fusion protein, 243 amino acids) KVRVHNVLKQQKNKSVSQVETEGAKQEREHLEMLIDQLKIKLQDSQNSLQISVSEYQTLQAEHD TLLERHNRMLQETVTKEAELREKLCSVQSENTMMKSEHSQTMCQLTSQNEALRTSFRDQVRH LQDEHRKTVETLQHQLSKLEAQLFQLKSEPSTRSPASSHQPSKSLRERRTTDLPLLDMHTVARE EGEGMETTDSESVSSAGTHIQSLEQLLSSPDTKLERLAETSLWHNEFTKEELA |
| Format | ：Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Immunoprecipitation, Immunohistochemistry. Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0491. This antibody detects endogenous mGCC2 protein
in several tissues and cells. Details are shown in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse GCC2 (KIAA0336)
Western blot analysis
- Adult Mouse Tissues -
- 10:Brain, 11:Prostate.6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney,
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cell
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Luke, M.R. et al.: J Biol Chem., 278, 4216 (2003).
Aliases for GCC2 Gene
- GRIP And Coiled-Coil Domain Containing 2 2 3 5
- GCC185 2 3 4
- GRIP And Coiled-Coil Domain-Containing Protein 2 3 4
- 185 KDa Golgi Coiled-Coil Protein 3 4
- Renal Carcinoma Antigen NY-REN-53 3 4
- CLL-Associated Antigen KW-11 3 4
- Ran-Binding Protein 2-Like 4 3 4
- CTCL Tumor Antigen Se1-1 3 4
- RANBP2L4 3 4
- KIAA0336 2 4
- GRIP And Coiled-Coil Domain-Containing 2 2
- Golgi Coiled-Coil Protein GCC185 3
- GCC Protein, 185-KD 3
- RanBP2L4 4
- REN53 3
- GCC2 5
