Anti-Mouse FBXW11 (KIAA0696) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje and Molecular layer)

Product#: FNK-MK06960310
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse FBXW11 (KIAA0696) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje and Molecular layer)


General information 

Cat. No. :FNK-MK06960310
Quantity 100 µg (200 µL)
Gene mouse F-box and WD-40 domain protein 11 (FBXW11) (mFBXW11, mKIAA0696)
Immunogen GX0195 (GST-fusion protein, 108 amino acids)
    CLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRL
    QFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Immunohistochemistry. Other applications have not been tested.
Specificity
Specific to recombinant protein GX0195. This antibody detects endogenous mFBXW11 protein
    in cerebellar purkinje and molecular layer cells.  Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Cenciarelli, C. et al.: Curr Biol., 9, 1177 (1999). 
 

Aliases for FBXW11 Gene

  • F-Box And WD Repeat Domain Containing 11 2 3 5
  • BTRCP2 2 3 4
  • F-Box And WD Repeats Protein Beta-TrCP2 3 4
  • F-Box/WD Repeat-Containing Protein 11 3 4
  • F-Box/WD Repeat-Containing Protein 1B 3 4
  • F-Box And WD-40 Domain Protein 1B 2 3
  • F-Box And WD-40 Domain Protein 11 2 3
  • Homologous To Slimb Protein 3 4
  • KIAA0696 2 4
  • FBXW1B 3 4
  • BTRC2 2 3
  • FBW1B 3 4
  • Fbw11 2 3
  • Hos 2 3
  • Beta-Transducin Repeat-Containing Protein 2 3
  • F-Box Protein Fbw1b 3
  • NEDJED 3
  • FBXW11 5
  • Fbw1b 2
  • HOS 4


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X