Anti-Mouse ERC2 (KIAA0378) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje cell)

Product#: FNK-MK03780310
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse ERC2 (KIAA0378) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje cell)


General information 

Cat. No. :FNK-MK03780310
Quantity :100 µg (200 µL)
Gene :mouse ELKS/RAB6-interacting/CAST family member 2 (ERC2) (mERC2, mKIAA0378)
Immunogen GX0090 (GST-fusion protein, 153 amino acids)
    LMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANI
    ALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDEDHHHYHHHHHHHHH 
    RSPGRSQHSNHRPSPDQDDEEGIWA
Format :Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Immunohistochemistry. Other applications have not been tested.
Specificity
Specific to recombinant protein GX0090. This antibody detects endogenous mERC2 protein in
    cerebellar purkinje cells. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Ko, J. et al.: J Biol Chem., 278, 42377 (2003).
  4. Takao-Rikitsu, E. et al.: J Cell Biol., 164, 301 (2004). 
 

Aliases for ERC2 Gene

  • ELKS/RAB6-Interacting/CAST Family Member 2 2 3 5
  • ERC Protein 2 3 4
  • KIAA0378 2 4
  • SPBC110 2 3
  • Spc110 2 3
  • CAST1 2 3
  • ELKSL 2 3
  • CAST 2 3
  • CAZ-Associated Structural Protein 3
  • Cytomatrix Protein P110 3
  • ERC2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X