Anti-Mouse DICER1 (KIAA0928) Polyclonal Antibody, Rabbit
Anti-Mouse DICER1 (KIAA0928) Polyclonal Antibody, Rabbit
DiagnoCine offers excellent DICER1 I Endoribonuclease Dicer Antibody to researchers studying RNA Pathway, Cellular Processes, Nuclease Activity, Hydrolase Activity, Endoribonuclease Activity, Deoxyribonuclease Activity, Ribonuclease III Activity and Regulation of Gene expression.
Human diseases include pleuropulmonary blastoma, ovarian sex cord-stromal tumors, lung cyst, cystic nephroma, renal sarcoma, Wilms tumor, nodular hyperplasia of the thyroid, nasal chondromesenchymal hamartoma, ciliary body medulloepithelioma, genitourinary embryonal rhabdomyosarcoma, pineoblastoma, and pituitary blastoma.
Anti-DICER1 I Endoribonuclease Dicer Antibodies Antibody has excellent quality and this highly pure antibody can be adapted for Western Blots, ELISA, Immunohistochemistry research with optimization.
General information
| Cat. No. | ：FNK-MKA0928AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Endoribonuclease Dicer (DICER1) (mDICER1, mKIAA0928) |
| Immunogen | ：GX0705 (GST-fusion protein, 203 amino acids) LYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQL EKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQ VYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKG KFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0705. This antibody detects mDICER1 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for DICER1 Gene
- Dicer 1, Ribonuclease III 2 3 5
- HERNA 2 3 4
- Dicer 1, Double-Stranded RNA-Specific Endoribonuclease 2 3
- Dicer 1, Ribonuclease Type III 2 3
- Endoribonuclease Dicer 3 4
- K12H4.8-LIKE 2 3
- Helicase MOI 3 4
- EC 3.1.26.3 4 51
- KIAA0928 2 4
- Dicer 2 3
- Dicer1, Dcr-1 Homolog (Drosophila) 2
- Helicase With RNAse Motif 3
- Helicase With RNase Motif 4
- Multinodular Goitre 1 2
- Dicer1, Dcr-1 Homolog 3
- EC 3.1.26 51
- Dicer1e 3
- DICER1 5
- RMSE2 3
- DICER 4
- DCR1 3
- GLOW 3
- MNG1 3
