Anti-Mouse CLTC (KIAA0034) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0034AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse CLTC (KIAA0034) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0034AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Clathrin heavy chain 1 (mCLTC, mKIAA0034) |
| Immunogen | ：GX0111 (GST-fusion protein, 140 amino acids) EHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGN WEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDA AKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHI VVHADELEELINYYQDRGF |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0111. This antibody detects mCLTC protein.
Other species have not been tested. |
| Storage | ：Store at -20°C or below. Avoid freeze-thaw cycles. |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type:Primary
- Application:ELISA,Western Blot
- Species:Human
- Recombinant:Yes
Human Diseases
- Neurodegenerative Diseases: Implicated in conditions like Alzheimer's due to its role in synaptic vesicle trafficking.
- Cancer: Altered clathrin function can affect tumor growth and metastasis.
- Genetic Disorders: Mutations can lead to disorders affecting endocytosis and cellular signaling.
Cellular Signaling Pathways
- Endocytosis Pathway: Clathrin is essential for the formation of coated vesicles, facilitating the internalization of receptors and ligands.
- Signal Transduction: Involvement in the internalization of signaling receptors, affecting pathways such as MAPK and PI3K.
Aliases for CLTC Gene
- Clathrin Heavy Chain 2 3 5
- Clathrin Heavy Chain On Chromosome 17 3 4
- Clathrin, Heavy Polypeptide-Like 2 2 3
- Clathrin, Heavy Polypeptide (Hc) 2 3
- Clathrin Heavy Chain 1 3 4
- CLH-17 3 4
- CLTCL2 3 4
- Hc 2 3
- Clathrin, Heavy Chain (Hc) 2
- Clathrin, Heavy Chain 2
- KIAA0034 4
- CHC17 3
- MRD56 3
- CLH17 4
- CLTC 5
- CHC 3
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- CLTC Clathrin Heavy Chain [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=1213.
- Open Source Research Methods, Safety, and Tools - CLTC UC Berkeley Center for Long-Term Cybersecurity.” CLTC, 24 Aug. 2023, cltc.berkeley.edu/about-us/citizen-clinic/citizen-clinic-cybersecurity-education-center/open-source-research-methods-safety-and-tools/.
- Academic Catalog.” Culture and Communication (CLTC) < Ithaca College, catalog.ithaca.edu/undergrad/coursesaz/cltc/.
