Anti-Mouse ARHGEF18 (KIAA0521) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0521AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse ARHGEF18 (KIAA0521) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0521AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Rho/Rac guanine nucleotide exchange factor 18 (mARHGEF18, mKIAA0521) |
| Immunogen | ：GX2113 (GST-fusion protein, 225 amino acids) IAEARTMKLQEFQERLSLKDQLIAQSLLEKQQIYLEMAQLSGLEESAQNRGLFRGGGDPSETLR GEQILRSAMSEIEGIQSLICQRHLGSTSSQVEEGSVSAGLPRRAETFGGYDSVGSPSKGGSFKR KVSNSDLRPQDWQGPASSPDSRPCDNSAPSGCCEESPQAVEMPSTESLPTVLELELVHRVQT LSQLLLSLQAVIAQQDSYVEMQRTAIQEREKQFRL |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX2113. This antibody detects mARHGEF18 protein. It also recognizes
human ARHGEF18 protein. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
Antigen Characterization
| Type | ：Protein |
| Application | ：ELISA, Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC-P) |
| Species | ：Human, Dog |
| Recombinant | ：Yes |
ARGEF18 in the Cell
- Functions as a guanine nucleotide exchange factor (GEF)
- Activates RhoA GTPases by stimulating GDP to GTP exchange
- Regulates cytoskeletal rearrangements, gene transcription, cell growth, and motility
- Localizes to adherent and tight junctions
- Recruited by proteins like Gα12, JAM-A, ZO-1, and JACOP
- Establishes cell tension at junctions
- Participates in focal adhesion formation
- Involved in p38 activation for cellular stress responses
ARGEF18 in the Human Body
- Contributes to various physiological processes, especially in endothelial and epithelial tissues
- Plays a role in endothelial cell mechano-sensitivity
- Responds to different magnitudes of shear stress
- Modulates endothelial cell behavior
- Maintains neuroepithelial integrity
- Controls apicobasal polarity
- Regulates proliferation in developing tissues
- Function appears conserved across vertebrates
- Expressed in multiple tissues:
- Brain
- Lungs
- Gastrointestinal tract
- Reproductive organs
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for ARHGEF18 Gene
- Rho/Rac Guanine Nucleotide Exchange Factor 18 2 3 5
- Rho/Rac Guanine Nucleotide Exchange Factor (GEF) 18 2 2 3
- P114RhoGEF 2 3 4
- 114 KDa Rho-Specific Guanine Nucleotide Exchange Factor 3 4
- Rho-Specific Guanine Nucleotide Exchange Factor P114 2 3
- Rho Guanine Nucleotide Exchange Factor 18 3 4
- Septin-Associated RhoGEF 3 4
- P114-RhoGEF 2 3
- SA-RhoGEF 3 4
- KIAA0521 2 4
- P114-Rho-GEF 4
- EC 3.4.24 51
- ARHGEF18 5
- MGC15913 2
- EC 3.6.1 51
- RP78 3
