Anti-Human TRIM28 Polyclonal Antibody, Rabbit
Product#: FNK-KB7016GNPAF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Human TRIM28 Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-KB7016GNPAF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：TRIM28 (Transcription intermediary factor 1-beta, TIF1-beta, Tripartite motif-containing protein 28, Nuclear corepressor KAP-1, KRAB-associated protein 1, KAP-1, KRAB-interacting protein 1, KRIP-1, RING finger protein 96) |
| Immunogen | ：GX5066 (GST-fusion protein, 166 amino acids) TKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSS AEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER GAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEAAIGA |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 40% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Human |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：This antibody detects human TRIM28 protein. Other species have not been tested.
|
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
Aliases for TRIM28 Gene
- Tripartite Motif Containing 28 2 3 5
- RNF96 2 3 4
- TIF1B 2 3 4
- KAP1 2 3 4
- Protein Phosphatase 1, Regulatory Subunit 157 2 3
- RING-Type E3 Ubiquitin Transferase TIF1-Beta 3 4
- Transcription Intermediary Factor 1-Beta 3 4
- E3 SUMO-Protein Ligase TRIM28 3 4
- KRAB-Interacting Protein 1 3 4
- Nuclear Corepressor KAP-1 3 4
- RING Finger Protein 96 3 4
- TIF1-Beta 3 4
- PPP1R157 2 3
- KRIP-1 3 4
- KAP-1 3 4
- TF1B 2 3
- KRAB [Kruppel-Associated Box Domain]-Associated Protein 1 3
- Transcriptional Intermediary Factor 1-Beta 3
- Tripartite Motif-Containing Protein 28 4
- Tripartite Motif-Containing 28 2
- KRAB-Associated Protein 1 4
- EC 2.3.2.27 4
- TRIM28 5
Recently Viewed
pFAST-G01 Vector (for Academic)
$2080.62
Saline
$0.00
AngioFlamma® FAM
$939.52
DNA Polymerase
$0.00
UltraClean PVSA Buffers
$0.00
Cytoskeleton Related
$0.00
KOD One™ PCR Master Mix, 1 pack
$250.32